Ch.re-SELENOM-1-U

General Information

Protein ID
986 
External ID
 

Protein Information

Protein Name
Ch.re-SELENOM-1-U 
Family
SELENOM 
Species
Chlamydomonas reinhardtii 
Genome
DS496117 
EST
gi|16431480|gb|BI996706.1|BI996706,gi|49458392|gb|BP086305.1|BP086305,gi|8514087|gb|BE121982.1|BE121982,gi|6541652|gb|AV387436.1|AV387436,gi|10780223|gb|AV636903.1|AV636903,gi|16438314|gb|BM003534.1|BM003534,gi|10126826|gb|BE725530.1|BE725530,gi|8828336|gb|BE212066.1|BE212066,gi|15694218|gb|BI718523.1|BI718523,gi|15694270|gb|BI718575.1|BI718575,gi|15692203|gb|BI716508.1|BI716508,gi|8287478|gb|BE025037.1|BE025037,gi|15696069|gb|BI720374.1|BI720374,gi|10779036|gb|AV635716.1|AV635716,gi|16432140|gb|BI997366.1|BI997366,gi|15702068|gb|BI726373.1|BI726373,gi|10127578|gb|BE726282.1|BE726282,gi|14239635|gb|BG858451.1|BG858451,gi|9460191|gb|BE453109.1|BE453109 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGGGCGCTCGCCTTGGCGCTCCTGGCGCTGGCTTTGATTGCGCAGCAAGCAAATGCCAAGGTCGCTCGTGGCGAGTTCATCAGCTGTCCCGGCTGACGCCTGAACCACCTGCCGGAGGTTAAGAAGTTCATTCGAGGGGACATCGAGAAGGATAAGGCCTACGAGAACCTCACAGTGAACTTCGTCCCCGGCAGGACCCCTGAGCTCGTGCTCTACGATGAGAATGGCGTGGAGATTGAGCGTATGTTCGTGGACAAGCTCAAGTACGACGAGCTCCACACGTTAGTGCAGAGCAAGGGCTTCAAGCGGAGAGACCCCAACGCTGCAGCGGCAACCACCACCGCTACCGCATCCACACGGCGTGCGCGCGCGGCTCGTCGCCTTCTCAGGGCGACAGAGGAGACCGCTTGCTAG 
Protein Sequence
MRALALALLALALIAQQANAKVARGEFISCPGURLNHLPEVKKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDENGVEIERMFVDKLKYDELHTLVQSKGFKRRDPNAAAATTTATASTRRARAARRLLRATEETAC* 
SECIS Sequence
MRALALALLALALIAQQANAKVARGEFISCPGURLNHLPEVKKFIRGDIEKDKAYENLTVNFVPGRTPELVLYDENGVEIERMFVDKLKYDELHTLVQSKGFKRRDPNAAAATTTATASTRRARAARRLLRATEETAC 

Structure Picture