Au.an-SELENOM-2-U

General Information

Protein ID
982 
External ID
 

Protein Information

Protein Name
Au.an-SELENOM-2-U 
Family
SELENOM 
Species
Aureococcus anophagefferens 
Genome
ACJI01001297 
EST
gi|119021253|gb|EH058509.1|EH058509,gi|161685901|gb|FC037297.1|FC037297 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGCGCGGCCTCCTGCTCGCGCTCCTCGCGGCCGCCGTAGGCGCGAGAATAACCGGAGAAGTGATCAGTTGCAACGCCTGAACGCTCAACCGCTTGCCCGAGGTGAAGCGATTTCTGAAGGGCAAGAGCGGCGCCATGAGCTACGACGACGTCGAGATCACCTGGATCCGCGGGCGCGCGCCGACGCTGCACATCAAGGAAGACGGCGTCGCGAAGGAGAGCATCAACCTCAGCACGTACACGGAAGAGAAGCTCCACGCGCTCTTCAAGGCCAAGGGCTTCCGACGACGGTTCAGCTTCGACGAGGAGCTCCACAAGCAGCCGGGCGTAAAATCAGTGGCGCGCTACACCAACACGGGCGGCGGCGCGATGCGCACGCCCCGGCTCCGCGGCGCGCCGATGCCCGGGAGATAG 
Protein Sequence
MRGLLLALLAAAVGARITGEVISCNAUTLNRLPEVKRFLKGKSGAMSYDDVEITWIRGRAPTLHIKEDGVAKESINLSTYTEEKLHALFKAKGFRRRFSFDEELHKQPGVKSVARYTNTGGGAMRTPRLRGAPMPGR* 
SECIS Sequence
MRGLLLALLAAAVGARITGEVISCNAUTLNRLPEVKRFLKGKSGAMSYDDVEITWIRGRAPTLHIKEDGVAKESINLSTYTEEKLHALFKAKGFRRRFSFDEELHKQPGVKSVARYTNTGGGAMRTPRLRGAPMPGR 

Structure Picture