5_Ch.re_MSRA_E

General Information

Protein ID
98 
External ID
 

Protein Information

Protein Name
5_Ch.re_MSRA_E 
Family
MSRA 
Species
Chlamydomonas reinhardtii 
Genome
 
EST
gi|14224351|gb|BG843167.1|BG843167,gi|6543016|gb|AV388800.1|AV388800 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCATCACCTACCACGAGCAGCAGCCGGAGGTTCAGTCGGGACATCTCCGCGATGGCGACTAACGGGAACGGAGCTTCTGGCGCGGAGCTCGCCACTTTCGCGCTTGGCTGATTCTGGCACCCGGAGGCTTCGTTCGCGAAGCTTCCCGGTGTGGTGAAGACTCGCGTGGGCTACACGGGCGGCAGCCGCCCCAACCCCACCTACGAGTCTGTGTGCGCTGGCGACGGCCACACAGAGGCGATGCGGGTCTGGNTTGACCCTGCCATCATCTCGTACGAGGACCTGCTCAAGCAATTCTTGCGGAAGCACGACCCCACCCAGAAGTGCAAATGCCAGTTCAAGTTTTTTGGGTGGGTCCATAGTTAG 
Protein Sequence
ASPTTSSSRRFSRDISAMATNGNGASGAELATFALGUFWHPEASFAKLPGVVKTRVGYTGGSRPNPTYESVCAGDGHTEAMRVWXDPAIISYEDLLKQFLRKHDPTQKCKCQFKFFGWVHS* 
SECIS Sequence
 

Structure Picture