4_Th.ps_SELENOT_E

General Information

Protein ID
942 
External ID
 

Protein Information

Protein Name
4_Th.ps_SELENOT_E 
Family
SELENOT 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162389342|gb|FC531054.1|FC531054,gi|162388836|gb|FC530534.1|FC530534,gi|162367115|gb|FC509305.1|FC509305,gi|162384743|gb|FC526455.1|FC526455 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGATTGCATTAATATTCGTGGCTGGATTCGTCAGTTTCGCGGCGGCGGAACCCAACACACAAAACCTACACAAAGCCTTTGTCCAGTTTTGCACTCAATGAGGTATGAAGGCCAACTTTCTCCGCGTACGCGAGATTCTCATCAATGAATTTCCTGGACAATGGAGCAGTATTGAAGGAGAAAACTACCCGGCTCCTGAATGGACTAAGTTGGCTGGAAGTGTGGTATCAGCGTTGCAAATATTTGGTATGGTGTTGGTGATGGTTGGAGATTCTATTTGGAGTTATATCCCTGGTTTTAGACGGGGTCCTCCCGAGGTGTACTACAAGTTGAAGGATAATCCGGCGTTGGCTTTGATTGGAGTCTTTTTGATCATTCCCTCGTACATTCAATCATTTGCAAATACTGGAGCTTTTGAAATCATGTTGGATGGGAAAGTGATATTCTCAAAGTTGGAGTTGGGGAGAATGCCAAACGTTGCCGAGATCATTAAAGCAGTAGAAAGTGCTGGATTGCATCGAGGTAGATAG 
Protein Sequence
MIALIFVAGFVSFAAAEPNTQNLHKAFVQFCTQUGMKANFLRVREILINEFPGQWSSIEGENYPAPEWTKLAGSVVSALQIFGMVLVMVGDSIWSYIPGFRRGPPEVYYKLKDNPALALIGVFLIIPSYIQSFANTGAFEIMLDGKVIFSKLELGRMPNVAEIIKAVESAGLHRGR* 
SECIS Sequence
 

Structure Picture