1_Au.an_SELENOH_Mg

General Information

Protein ID
930 
External ID
 

Protein Information

Protein Name
1_Au.an_SELENOH_Mg 
Family
SELENOH 
Species
Aureococcus anophagefferens 
Genome
ACJI01001708 
EST
gi|161659075|gb|FC011122.1|FC011122 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGCGCCGAGCTTCCTGGTGACCTACTGCAAGAACTGAGACGGGGGGCAGCAGGAGTTCTCTGCTGCCAAACAGGCGATCCTCGACGAGTTCCCCGGCGCGGACGTGTCGCCGAACCGCGTCGACGCGTACCCCATCAAGGTCACCATCGACGCGACGACCGACGGCGCGAAGACGCAGGTCTGGTCTGGCAGTCAGAAGGACCTCTTCTCCAAGTACGGCCACCGCGCCGTGCCGGAGATCAAGAAGTCGCTCCAGAAGCTCAAGTAG 
Protein Sequence
MAPSFLVTYCKNUDGGQQEFSAAKQAILDEFPGADVSPNRVDAYPIKVTIDATTDGAKTQVWSGSQKDLFSKYGHRAVPEIKKSLQKLK* 
SECIS Sequence
VTYCKNUDGGQQEFSAAKQAILDEFPGADVSPNRVDAYPIKVTIDATTDGAKTQVWSGSQKDLFSKYGHRAVPEIKKSLQ 

Structure Picture