6_Em.hu_SELENOM_E

General Information

Protein ID
925 
External ID
 

Protein Information

Protein Name
6_Em.hu_SELENOM_E 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
 
EST
gi|58184487|gb|CX774134.1|CX774134,gi|115600596|gb|EG032823.1|EG032823,gi|58185518|gb|CX775165.1|CX775165,gi|58185858|gb|CX775505.1|CX775505,gi|115598550|gb|EG030915.1|EG030915,gi|58182472|gb|CX772119.1|CX772119 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GGCGTCGTAAAGTCTTGCCCTGCTTGAGGGCTCGACGCGCTGCCGATGGTGAAAAAATTCCTCAAGTCGCCGGGCGGCGTGGAGCTCTATCCATCCGTGAACATCGAGTGGATCAAGGGCCATGACCCGACTCTCTACGTGACAGGTGACGGCCCAGCGGAAGAGATCGGACTCGGCAAGTTCAACTACACACAGCTACACGAACTCTTCGCCCGCAAGTTTGGGCGCGTGGCCTTGCGAGATGAAGCGGCCGGCTCAACCTGGAAGAGGCCGGCTGCGGACGATGCAGGGTCGCCTGCCGGAGCAGGCAGCAGGAGACTCCTCTTCATGCTGACGGGCGGAGCGATCGTCACAGCGCTCTACGCTGCAGCCGCGCGGCGCTCTCGCGCCCGCGGCGGCTGGGACGCAGCGAACGACGAAGACGAGCTGAAGCAACGGCTCACGGCATGA 
Protein Sequence
GVVKSCPAUGLDALPMVKKFLKSPGGVELYPSVNIEWIKGHDPTLYVTGDGPAEEIGLGKFNYTQLHELFARKFGRVALRDEAAGSTWKRPAADDAGSPAGAGSRRLLFMLTGGAIVTALYAAAARRSRARGGWDAANDEDELKQRLTA* 
SECIS Sequence
 

Structure Picture