1_Os.sp_MSRA_E

General Information

Protein ID
92 
External ID
 

Protein Information

Protein Name
1_Os.sp_MSRA_E 
Family
MSRA 
Species
Ostreococcus sp. RCC809 
Genome
 
EST
gi|254310799|gb|GR823673.1|GR823673 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GAAATCGCCAAGGGTGACGGTTTCGTCGTCCCAGAAGGTTGTCAGCTCGCGGTGTTCGCGTCCGGGTGATTTTGGGGCCCCGACGCCGCGTTCAGCGCCCTCAAGGGGGTGAAGAAAACGCGCGTCGGTTATACTGGCGGTGATACCGATTTTCCGACGTACTCGCAGGTGTGCGCGGGCGGGACGGGGCACACGGAGGCGTACTACGTGTGCGCCGACGCGGGGGTCATCGGCTACGACAAACTTCTCGAACAGTTTTGGTCCGAGCATCAGCCGACGTACGAGTCCAAGGCGCAGTATAAGTCTGCGATCTGGGCGCAGACGCCGGAACAGTACGAGATGGCTTTGGCGAGCAAGGATGCCGCCGAGAAGCGCGTGGGGAGGAAGATGTTCACGGATATTTATCCACCGGAAGTTTCCCACAGCGTCTCGTGGTGGGACGCGGAAGAATATCATCAAAAGTACTATTGCAAACCTCGCGCCTCGAGATTTGGTTGGTGA 
Protein Sequence
EIAKGDGFVVPEGCQLAVFASGUFWGPDAAFSALKGVKKTRVGYTGGDTDFPTYSQVCAGGTGHTEAYYVCADAGVIGYDKLLEQFWSEHQPTYESKAQYKSAIWAQTPEQYEMALASKDAAEKRVGRKMFTDIYPPEVSHSVSWWDAEEYHQKYYCKPRASRFGW* 
SECIS Sequence
 

Structure Picture