Th.oc-MSRA-1-U

General Information

Protein ID
914 
External ID
 

Protein Information

Protein Name
Th.oc-MSRA-1-U 
Family
MSRA 
Species
Thalassiosira oceanica 
Genome
AGNL01002964 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATCTGTCCAGAAATTTCTACTGAGCCACGTCGGCCAAAGCACGAAGTGGCATTATTGGCTTCTGGCTGATTCTGGCACCCGCAGCGAGACTTTAAGCGTTTGCGGGGGGTGAAAGACTGCATCGTCGGGTACACAGGGGGGAAAGAAAAGAACCCGACCTACCAGGCGATCAAGGACTCCACCGAGAGTTTCATGGTTGAGTTTGATCCAGAGGCGATCTCTTACGCACAAATTCTTGACGTGTGGTCAGACCAGCATGCGCCCTACTACCCGTCAAGTTGCCAGTATCGATCTGCAATATTTTACACCAATGATGAGCAGAAGGTGGCCGCTGAGAACAAGGTAGTCGAACTCTCGAAGGGCGGGACTAGGAAGGTTTACGTTGGTGTCGAGCCTGCATCTGCCTTCTACAAAGGAGAGGAGTACCACCAGGACTTCCTCGACAAGCAAACCAGCGCAAGAAGTCCCATGTTC 
Protein Sequence
ICPEISTEPRRPKHEVALLASGUFWHPQRDFKRLRGVKDCIVGYTGGKEKNPTYQAIKDSTESFMVEFDPEAISYAQILDVWSDQHAPYYPSSCQYRSAIFYTNDEQKVAAENKVVELSKGGTRKVYVGVEPASAFYKGEEYHQDFLDKQTSARSPMF 
SECIS Sequence
GUCGAUUAAAAAGGCGUUACUUGUUUUAGAUUGAAGUCACGACGUAAACUCGAAUGAGCUUGUCAGAGUAACCCGCGAACAGAGUCGAGCCGUCUGCGCUCCA 

Structure Picture