5_Th.ps_SELENOT_E

General Information

Protein ID
903 
External ID
 

Protein Information

Protein Name
5_Th.ps_SELENOT_E 
Family
SELENOT 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162389115|gb|FC530690.1|FC530690 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGATTGCATTAATATTCGTGGCTGGATTCGTCAGTTTCGCGGCGGCGGAACCCAACACGCAAAACCTACACAAAGCCTTTGTCCAGTTTTGCACTCAATGAGGTATGAAGGCCAACTTTCTCCGCGTACGCGAGATTCTCATCAATGAATTTCCTGGACAATGGAGCAGTATTGAAGGAGAAAACTACCCGGCTCCTGAATGGACTAAGTTGGCTGGAAGTGTGGTATCAGCGTTGCAGATATTTGGTATGGTGTTGGTGATGGTTGGAGATTCTATTTGGAGTTATATCCCTGGTTTTAGACGGGGTCCTCCCGAGGTGTACTACAAGTTGAAGGATAATCCGGCGTTGGCTTTGATTGGAGTCTTTTTGATCATTCCCTCGTACATTCAATCATTTGCAAATACTGGAGCTTTTGAAATCATGTTGGATGGGAAAGTGATATTCTCAAAGTTGGAGTTGGGGAGAATGCCAAACGTTGCCGATATACTTTGA 
Protein Sequence
MIALIFVAGFVSFAAAEPNTQNLHKAFVQFCTQUGMKANFLRVREILINEFPGQWSSIEGENYPAPEWTKLAGSVVSALQIFGMVLVMVGDSIWSYIPGFRRGPPEVYYKLKDNPALALIGVFLIIPSYIQSFANTGAFEIMLDGKVIFSKLELGRMPNVADIL* 
SECIS Sequence
 

Structure Picture