Ch.hs-SELENOM-1-U

General Information

Protein ID
902 
External ID
 

Protein Information

Protein Name
Ch.hs-SELENOM-1-U 
Family
SELENOM 
Species
Chlamydomonas sp. HS-5 
Genome
 
EST
gi|6448299|gb|AU066510.1|AU066510 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCGCTTCCCCACGTTGGCTTCGCTGCTTCTGCTGCTGACGGTGGCAGGCGCGGCTGCTCAGGAGGCCGCGTCCGCCCCCGCTTACGAGCTCAACGAGGCCGGCCAGCGCATGGTCTTCATCTCATGCTCTGGATGACGTCTGAAGCACCTGCCGGAGGTGAAGCGCTTCCTGTACGACGTGGTCAGACCCAATCTGTACCATGGCGTTACGGTGGACTTCACCCCCGGCAGGAGTCCGGCGGCATACTTGTATGACGCGACAACCAGCTGGTGGATGATGGCTATGACGTGTCGGGCATGAAGTTTGATGAGCTGCACACGTTCGTGCGTTCAAAGGGCTTTGTACTCAAGACGGAAATGGCCGGTGGCGTTGCTGATGACGCAGAGGAGGCCAAGCCAAGTCAGCATGATGAGTTCTGA 
Protein Sequence
MRFPTLASLLLLLTVAGAAAQEAASAPAYELNEAGQRMVFISCSGURLKHLPEVKRFLYDVVRPNLYHGVTVDFTPGRSPAAYLYDXNQLVDDGYDVSGMKFDELHTFVRSKGFVLKTEMAGGVADDAEEAKPSQHDEF* 
SECIS Sequence
 

Structure Picture