Ka.br-SELENOM-1-U

General Information

Protein ID
901 
External ID
 

Protein Information

Protein Name
Ka.br-SELENOM-1-U 
Family
SELENOM 
Species
Karenia brevis 
Genome
 
EST
gi|159023624|gb|EX979546.1|EX979546 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGCTTGTTGCAGTTGTGCTCCTCGGCGTTGTTGCTGCAGCTGAGCCCAACCCTGCCGCCTCAAAGGCGAGCTTTGACACAAACACCACAAGGTGGCAGGGCCGGTGTGGGCGTATCATCTCCTGTCCTGGCTGAAGGCTGAATGGCTTACCTGAAGTTAAGAAGTTTCTCAAAGGACCTGATGGTGCGAAGCTGTACCCAGCAGTGGAGATCTCTTGGGTTCGAGGCAAAGACCCAGAGCTGCAGGTCTACGACTGCGCCGGCAAGCCACCGCCCGGCAAGCCGGAGACGGCTGCCTCGGAGCCGTTGGAGTCTCTGAGCCTCTCGCCGTACACGCACGAGCAGCTGCACTGGCTGCTGCAGTGCCATGGCCTTTCACATCCCAAGACCTCCAATGACACTGCTGAGATGCCTGGGTTGCTCTCAACTGAGAAAGCCTGCAGTGCTTTGGCTGCCGTTGACAGCAGCAGGTGGTGGTGGTTCGTCACAACGGCTCTGGGAGTTGCAGCAATCCTTCTCGTGGTGATTTGGTGTATATGCGGATTGCCCTCATTGCGTCCGTTGTTGAATGGAAAGAAGAAGAAGTGCGAGGATGATGCAAGCTCGCACGCTGAGCTCGAGATGACATGA 
Protein Sequence
MALVAVVLLGVVAAAEPNPAASKASFDTNTTRWQGRCGRIISCPGURLNGLPEVKKFLKGPDGAKLYPAVEISWVRGKDPELQVYDCAGKPPPGKPETAASEPLESLSLSPYTHEQLHWLLQCHGLSHPKTSNDTAEMPGLLSTEKACSALAAVDSSRWWWFVTTALGVAAILLVVIWCICGLPSLRPLLNGKKKKCEDDASSHAELEMT* 
SECIS Sequence
 

Structure Picture