1_Fr.cy_SELENOH_G

General Information

Protein ID
898 
External ID
 

Protein Information

Protein Name
1_Fr.cy_SELENOH_G 
Family
SELENOH 
Species
Fragilariopsis cylindrus 
Genome
scaffold_135 
EST
 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TCAAAGAACTGAGATGGAGGGAAACAGGAATACAATACAGCGTTGGACGTTGTGAAAAAAGTATTTCCTTCCTCACAAATAATTGAAAATCGTGTTGATACATATCCAATACGAGTAATTGTTACTGCGCATACCAGTGATGGTATTGATGCAATAGAAATTTGGTCAGGAAGACAACAAGATTTATTTTCAAAA 
Protein Sequence
SKNUDGGKQEYNTALDVVKKVFPSSQIIENRVDTYPIRVIVTAHTSDGIDAIEIWSGRQQDLFSK 
SECIS Sequence
 

Structure Picture