Bi.na-MSRA-1-U

General Information

Protein ID
883 
External ID
 

Protein Information

Protein Name
Bi.na-MSRA-1-U 
Family
MSRA 
Species
Bigelowiella natans 
Genome
ADNK01000514 
EST
gi|66861120|gb|DR040635.1|DR040635,gi|66861773|gb|DR041288.1|DR041288,gi|66859757|gb|DR039272.1|DR039272,gi|66860492|gb|DR040007.1|DR040007,gi|66860516|gb|DR040031.1|DR040031,gi|66860458|gb|DR039973.1|DR039973,gi|66861845|gb|DR041360.1|DR041360,gi|66858870|gb|DR038385.1|DR038385 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGAAACCCCGGCCAACACTGCAACCTTCGGTATGGGCTGATTTTGGGGGCCAGAAGTTACCTTCGCGCCTAAGAACGTTCCCGGCGTTCTGAGTACGCGCGTTGGTTATGCGGGAGGGAAGAAGAAGAATCCGACTTATCATTCGCTCGGAGATCATACAGAAGTTATTCAAATCACCTTTGATCCAGCTAAGGTTAGCTACAGCAAAATTGTAGACATTTTCTTCTCGGAGCATTCGTTTCGCTCGAAGCCATACTGCAGGCAGTACATGTCAGGAGCATGGTATCAGAACGAGGAACAAAAAGAAGTCCTTGCTAAGAAAGTAGCTGAGCTTGAAAAAAGAGGTAAAAGAGATGGAAAAGTTTACACGGAAATAGCCCCTCTAGGGGATTTCTACTACGCTGAAGAGTATCATCAGAAGTACTTCGAAAAGGCTGGTCGTGCCTAA 
Protein Sequence
METPANTATFGMGUFWGPEVTFAPKNVPGVLSTRVGYAGGKKKNPTYHSLGDHTEVIQITFDPAKVSYSKIVDIFFSEHSFRSKPYCRQYMSGAWYQNEEQKEVLAKKVAELEKRGKRDGKVYTEIAPLGDFYYAEEYHQKYFEKAGRA* 
SECIS Sequence
TATFGMGUFWGPEVTFAPKNVPGVLSTRVGYAGGKKKNPTYHSLGDHTEVIQITFDPAKVSYSKIVDIFFSEHSFRSKPYCRQYMSGAWYQNEEQKEVLAKKVAELEKRGKRDGKVYTEIAPLGDFYYAEEYHQKYF 

Structure Picture