Is.ga-SELENOT-1-U

General Information

Protein ID
881 
External ID
 

Protein Information

Protein Name
Is.ga-SELENOT-1-U 
Family
SELENOT 
Species
Isochrysis galbana 
Genome
 
EST
gi|106826175|gb|EC144552.1|EC144552 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTACGAGAAGCCAAGCTCTGTCGACCTTTCCTCATTTTCGCTCGTCGAGAGGCCAGCCATAGAGAGGCTAGACTCAACGGTGCGGATTGAGTTTTGCCGGTCGTGACAGACCGCCGGAGCCTTCAAGCAGTGCGCCACTGCGCTGCAGCGCTCCTTCCCAGATGTCCGTATCGAGGGCGGAGAGTACACTCCCCCAGTCAGCGTGCAGTACGCCATCCGCGCCATCCGCGCAAGTCAGCTGGCTGTCGCGGCCGGCTACTTTTTTGGGGCCCAGGCTGCCGCCTCGCTGCGCCGCGCCCCGCCCGCGCTCGTTGAGCAGATGAGCGACAACCCGATGATGGCCATCGGCTCCGTCTTCGGCTTAGACGTTTGTGGCGCAGACTCTGCACTCCATCAACGCCTTTGAAATCACTTATAATGGCCAAAAGCTGCACTCCAAACTGAGCACCGGCCGGCTGCCTCGTCCCGACGAGCTGATCGCACGCCTGGCCCAAGTACGGAAGAGCGAGGCGCTCGCAACAGGCTCC 
Protein Sequence
MYEKPSSVDLSSFSLVERPAIERLDSTVRIEFCRSUQTAGAFKQCATALQRSFPDVRIEGGEYTPPVSVQYAIRAIRASQLAVAAGYFFGAQAAASLRRAPPALVEQMSDNPMMAIGSVFGLXFVAQTLHSINAFEITYNGQKLHSKLSTGRLPRPDELIARLAQVRKSEALATGS 
SECIS Sequence
 

Structure Picture