Pa.lu-SELENOT-1-U

General Information

Protein ID
88 
External ID
 

Protein Information

Protein Name
Pa.lu-SELENOT-1-U 
Family
SELENOT 
Species
Pavlova lutheri 
Genome
 
EST
gi|106858709|gb|EC177086.1|EC177086 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCTCGAGATCGTCGTGCGGTACTGCGCGTCGTGAGGATACGGGAACATGTTCCAGCAGTTCAGATCGATCATGCAGCGCGAGTTCCCGCACGCGCGCTTCGACGGCGGCGTCCTCTCGCCCGGCTGGTACGCCGAGACGGGCGCGCAGTTCTTGTCGCTCGGCTTCTTCGGCACAGTCATTTCGCTCTTCGCGGGCGAGTACTTCCTGCCGCCGCCGGTCGCGACGGTGATCTCGGCGAATAAGGGTGCGGCCTTCTTCACCGCGATGGCGATGAACCTGCTCGCAGGCAAGCTCATCGCCACGTCTGCCTTCGAAATCCTCGTCAACGGAATCCCCGTCTTCTCAAAGCTCCAGTCGGGCGCGTTGCCGACCATCGACACCGTTGTGTCCGACGTGCACAGGATGGCGGCGGGCGCCTTTTGA 
Protein Sequence
MLEIVVRYCASUGYGNMFQQFRSIMQREFPHARFDGGVLSPGWYAETGAQFLSLGFFGTVISLFAGEYFLPPPVATVISANKGAAFFTAMAMNLLAGKLIATSAFEILVNGIPVFSKLQSGALPTIDTVVSDVHRMAAGAF* 
SECIS Sequence
 

Structure Picture