Em.hu-SELENOM-3-U

General Information

Protein ID
879 
External ID
 

Protein Information

Protein Name
Em.hu-SELENOM-3-U 
Family
SELENOM 
Species
Emiliania huxleyi 
Genome
KB865703 
EST
gi|261442125|gb|FP185935.1|FP185935 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGGTTTGTGACAGCGACAAGCCGAGGATAGCGCGCGGCGAGATCCGCACTTGCTCGGGGTGACGGCTAAACAGTTTCCCAGAAGTTCGGGAGTTTGTCCGCTCGGACCTGCACGCGGGGCGGTACGAGAACCTCAAGGTCGTGTACATCAACCACCACAACCCGGACCTTTTCCTGCTGACCGAGGACGGCAGCGAAGTCATGAAGATTGATCTGACGCGGCTGTCTTCCATCGCTTCGCTTCACAAGCTGATGTCGCTTCTCGGGCTGCGCGAAATTTGCGGCGACGCAGACGAGCGATGCGCCGGCTGGTCCAGCAAAGGGGAGTGCGACCGGAACGAAGGCTTTATGCACACCAACTGCAGGAAGGCGTGCGGGCTGTGCGCAGAGGGCGCCAAGCAGGCCGAGGGCACCCTCTGCACGGACGCCGAGTCGGCAAACAACTGCCAGTACTGGTCCACTATG 
Protein Sequence
MVCDSDKPRIARGEIRTCSGURLNSFPEVREFVRSDLHAGRYENLKVVYINHHNPDLFLLTEDGSEVMKIDLTRLSSIASLHKLMSLLGLREICGDADERCAGWSSKGECDRNEGFMHTNCRKACGLCAEGAKQAEGTLCTDAESANNCQYWSTM 
SECIS Sequence
IARGEIRTCSGURLNSFPEVREFVRSDLHAGRYENLKVVYINHHNPDLFLLTEDGSEVMKIDLTRLS 

Structure Picture