Fu.se-SELENOT-1-U

General Information

Protein ID
869 
External ID
 

Protein Information

Protein Name
Fu.se-SELENOT-1-U 
Family
SELENOT 
Species
Fucus serratus 
Genome
 
EST
gi|229052688|gb|GH695650.1|GH695650,gi|229049400|gb|GH694859.1|GH694859,gi|229052285|gb|GH695487.1|GH695487,gi|229053308|gb|GH695895.1|GH695895 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCCATACAACTCACCCCTGCCCGCGGGCCTCGGCCCCGTGCCACGAGTGCTTGTTCAATATTGCTCTTCGTGAGGCATGCGGAGGAACTTCGATGAGCTTCGGTCGTTCCTCCACCTTCACTTCCCTGTCCTCGCGGAGGCAGACAGCATCCGGGGAGAACTGTACCCGCCCCCGGCGTATGCGCAGACGCTCGCCACGCTGGGTTCTTACGCCCAGATGGGTGGCATAGCCGTCACCCTCGGAGGGTCTCTAATCTTCGGTACCCTCGGAGTACCAGAGCCCTTCTTCGTCCCGGTTATGCAGCGCAACTCCGTCCGCACGGTTATCGGACTCTTTGTCTTCAACTCGTTATGCAGCCAGTTCCTACAGACAGGCGCTTTCGAGGTTTGGATCGACGACGAGCTGGTTTTCTCTCGGCTAGAAACTAAGGGCACGTTCCCCTCTGGAGCGGTGCTCATCAGCTCGCTAGAAAAACACGGGTTGCGAAGTACCAAGAACTCCTAA 
Protein Sequence
MPYNSPLPAGLGPVPRVLVQYCSSUGMRRNFDELRSFLHLHFPVLAEADSIRGELYPPPAYAQTLATLGSYAQMGGIAVTLGGSLIFGTLGVPEPFFVPVMQRNSVRTVIGLFVFNSLCSQFLQTGAFEVWIDDELVFSRLETKGTFPSGAVLISSLEKHGLRSTKNS* 
SECIS Sequence
CGGUCGUUUUUCUAUUAGCCUCCGAGCUUAAUGACGGACAGCAUACCCAAAGGCGCCCGUAAACGCACGGUGUUGACCUGAAAUGCCGGAAACUGGUAGUCGUCGC 

Structure Picture