Vo.ca-SELENOH-1-U

General Information

Protein ID
86 
External ID
 

Protein Information

Protein Name
Vo.ca-SELENOH-1-U 
Family
SELENOH 
Species
Volvox carteri 
Genome
GL378374 
EST
gi|167163971|gb|FD886172.1|FD886172,gi|167085295|gb|FD808511.1|FD808511,gi|167204560|gb|FD926385.1|FD926385 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
CGAAAGGCTGCCGGAGAGGCTTCTGGTGCAAAAGCGCCTGCTGCTAAAAAACAGGCAAAGAAGGATGACGGCCCTGCATCGGATGCTGCGCCTGGCAGAGGCATTGTCATCGAGGCATGCAAGAGCTGAGGCGCATTCAAAACACGGGCCACTAAGTTAGAGAAGCTAATTAAGGAGGCGATTCCGGACGCCCAAGTCAGCATCAATCCAGACAAGCCACGCAAGGGCTGTTTTGAAGTGCGGGGTCCTGACGGCAAAGTCTTCTTGTCGTTGCTGGACATGCCCCGTCCCTTCACAAAGCTCAAAGCTCTGGATGTCGAAGCGCTCGCCAAGGAAGTGTCGGACAGCCTCAAAAAGGAGTAG 
Protein Sequence
RKAAGEASGAKAPAAKKQAKKDDGPASDAAPGRGIVIEACKSUGAFKTRATKLEKLIKEAIPDAQVSINPDKPRKGCFEVRGPDGKVFLSLLDMPRPFTKLKALDVEALAKEVSDSLKKE* 
SECIS Sequence
AAGEASGAKAPAAKKQAKKDDGPASDAAPGRGIVIEACKSUGAFKTRATKLEKLIKEAIPDAQVSINPDKPRKGCFEVRGPDGKVFLSLLDMPRPFTKLKALDVEALAKEVSDSLKK 

Structure Picture