Ka.br-MSRA-2-U

General Information

Protein ID
848 
External ID
 

Protein Information

Protein Name
Ka.br-MSRA-2-U 
Family
MSRA 
Species
Karenia brevis 
Genome
 
EST
gi|194481126|gb|FK837805.1|FK837805,gi|194478873|gb|FK837857.1|FK837857,gi|194497355|gb|FK854120.1|FK854120,gi|194497090|gb|FK852698.1|FK852698,gi|194488924|gb|FK851058.1|FK851058,gi|48706725|gb|CO064556.1|CO064556,gi|194497794|gb|FK855939.1|FK855939,gi|194498740|gb|FK857531.1|FK857531,gi|194486066|gb|FK844885.1|FK844885,gi|194494760|gb|FK856108.1|FK856108,gi|194486710|gb|FK844571.1|FK844571 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTCGAAGAAGGCCTCATCGAAAGTCGAAGTTGCGACGTTCGCAATGGGCTGATTCTGGGGGCCGCAGGCTGAATTTGACAAAGTACCTGGAGTGGTGAAAACTACTGTGGGCTACACTGGTGGATCGAACCCGCACCCAACATATGAGTCTGTCTGTGCTGGAGATGGACACACCGAAGCTATCAAGATTGAGTACGATCCCTCAAAGGTCTCGTATGACTCCTTGCTCAACAAGTTCCACAGTGGCTGCAGTGGACATTCGGGCGGGAATCCGCAGTACAAGTCTGCAGTTTGGGTCCATAGCGAGGAGCAGCGAGCTGCGGCTCAAGAGGCTGCCAAAACTCGAGGTCGTTCCAGCCGCCTCCAGATTGAAAATGCGCCTGCGTGGCACGATGCGGAGGGTTATCACCAGAAATACTACCAGAAACAAGGTTGCCATCAGATGTAG 
Protein Sequence
MSKKASSKVEVATFAMGUFWGPQAEFDKVPGVVKTTVGYTGGSNPHPTYESVCAGDGHTEAIKIEYDPSKVSYDSLLNKFHSGCSGHSGGNPQYKSAVWVHSEEQRAAAQEAAKTRGRSSRLQIENAPAWHDAEGYHQKYYQKQGCHQM* 
SECIS Sequence
UUGAAGAUGCCUGGUUGUGCAGAGAUGUGCAUGAAAUUAGCUUGAGCAAAGAAGACUUUGUUGCUGUGCUCAGCAGGUCUGAAGUGUCUUUAAGUUUGCUGCGC 

Structure Picture