Gl.no-SELENOM-2-U

General Information

Protein ID
847 
External ID
 

Protein Information

Protein Name
Gl.no-SELENOM-2-U 
Family
SELENOM 
Species
Glaucocystis nostochinearum 
Genome
 
EST
gi|106805650|gb|EC124027.1|EC124027,gi|106800765|gb|EC119142.1|EC119142,gi|106804435|gb|EC122812.1|EC122812,gi|106806226|gb|EC124603.1|EC124603,gi|106804235|gb|EC122612.1|EC122612,gi|106805694|gb|EC124071.1|EC124071,gi|106800095|gb|EC118472.1|EC118472 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAAGGTCGCGGTGGCCCTCTGCTCGCTTCTGTGCCTTTCATTTTTCGCTGTTGGTTTTACCGATGAATCTGTTGACGATAACCCTGTTTCTGCAAGTCGAGTTCGGCTTGAGACCTGCAGCGGATGACGTTTAAATCACCTTCCTGTTGTGAAGGGCTTTATAACGCAGGAGGCCAAGGAGTATCCTAACCTTGAGGTCAAATACATTCCTGGACTTACACCTCGTTTTGTTTTCCTCGACGAGAACGACGAGACTATCCATCAAAAGGAGATCGACTCCTTCTCAAATGATCAAATTCATGATTACTTGAAGAAGTTCGGCATCGAGCGGGTCGCGCCGAAGCCCGAAGAGGAGCTCTAA 
Protein Sequence
MKVAVALCSLLCLSFFAVGFTDESVDDNPVSASRVRLETCSGURLNHLPVVKGFITQEAKEYPNLEVKYIPGLTPRFVFLDENDETIHQKEIDSFSNDQIHDYLKKFGIERVAPKPEEEL* 
SECIS Sequence
GUCAAGGACACAUUUGAUAGCAGCGGAAUGAAACUAGCUGUCGUAAACCUCUGGUAGACAGCCGGAUGAAAAGCUUGCGUCAUCUGCUGA 

Structure Picture