1_Pr.pa_SELENOT_E

General Information

Protein ID
845 
External ID
 

Protein Information

Protein Name
1_Pr.pa_SELENOT_E 
Family
SELENOT 
Species
Prymnesium parvum 
Genome
 
EST
gi|383203271|gb|HE782097.1|HE782097 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATGAGCTGAGGGTACAAGAAGGCGTTCGAAGACTATGCTCGAGCGCTGCACCACGAGTACCCCCACATCAAATATTCCGGCGGCACCTTCAATCCTGGAGATGTGCGCGTCGCCTTGGCTCAGATCTTACAGCTCTGCTTCTTCGCGGGCATTGCCCTCGCGATGGGGGGGAAGAAGCTTCTTCCGGAGCATATGCAAAAGACAATTGATGAGCATCCGATGCCCGCGATGCTCCTCGTTTTCTTCCGCAATATGGCCGCCGGGGCTCTGCTCAACACTGGAGCGTTCGAGATGAGTTACAATGGCATGCCCATCTGGTCGAAGCTGGACACAGGGCGTCTTCCCCACACGGTTGAGCTGAAAGACGCATTGTCCGCTGTGGCCTTCGAGCGATAG 
Protein Sequence
MSUGYKKAFEDYARALHHEYPHIKYSGGTFNPGDVRVALAQILQLCFFAGIALAMGGKKLLPEHMQKTIDEHPMPAMLLVFFRNMAAGALLNTGAFEMSYNGMPIWSKLDTGRLPHTVELKDALSAVAFER* 
SECIS Sequence
 

Structure Picture