Pr.pa-SELENOT-1-U

General Information

Protein ID
838 
External ID
 

Protein Information

Protein Name
Pr.pa-SELENOT-1-U 
Family
SELENOT 
Species
Prymnesium parvum 
Genome
 
EST
gi|383202357|gb|HE782443.1|HE782443 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TACTGCATGAGCTGAGGGTACAAGAAGGCGTTCGAAGACTATGCTCGAGCGCTGCACCACGAGTACCCCCACATCAAATATTCCGGCGGCACCTTCAATCCTGGAGATGTGCGCGTCGCCTTGGCTCAGATCTTACAGCTCTGCTTCTTCGCGGGCATTGCCCTCGCGATGGGGGGGAAGAAGCTTCTTCCGGAGCATATGCAAAAGACAATTGATGAGCATCCGATGCCCGCGATGCTCCTCGTTTTCTTCCGCAATATGGCCGCCGGGGCTCTGCTCAACACTGGAGCGTTCGAGATGAGTTACAATGGCATGCCCATCTGGTCGAAGCTGGACACAGGGCGTCTTCCCCACACGGCTGAGCTGAAAGACGCATTGTCCGCTGTGGCCTTCGAGCGATAG 
Protein Sequence
YCMSUGYKKAFEDYARALHHEYPHIKYSGGTFNPGDVRVALAQILQLCFFAGIALAMGGKKLLPEHMQKTIDEHPMPAMLLVFFRNMAAGALLNTGAFEMSYNGMPIWSKLDTGRLPHTAELKDALSAVAFER* 
SECIS Sequence
CCUUUGCUCACAUGCUUCUGAUCUUCCUGUAUGAUUCGCCGUCGGUAAAUGGGCUUAUUGUCCAGUCAAUGGCGUUGAUAGUCGGAAGGCGCAGGCACAUG 

Structure Picture