1_Ph.tr_SELENOM_E

General Information

Protein ID
836 
External ID
 

Protein Information

Protein Name
1_Ph.tr_SELENOM_E 
Family
SELENOM 
Species
Phaeodactylum tricornutum 
Genome
 
EST
gi|144629060|gb|CT897331.1|CT897331 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
AGAATCACGAGTCTTTTCAGGTGCGCTCATTTGCTGGCGTTTTGCTTCCTTGCTTACTCATTCGCCAGCCCGGAAGCCGACATCGTTTCCTGTGGAGGATGAATGTTAAACCGCATGCCCGAGCTCAAAAGCTTTCTCAAAGACGGCGAAGCAGAATGGTATGTGGGGGTTAATGTGACCTACGTTACGGGTCGTCGAGCGGTCATGCACATATATAACGAAGGAGGGAGCAAAGTGGAGGTCATTGATTTAAACTGTAAGTAAGTTGCAGACGAAAAAAGCATTGCATGCTTTGATGGCAGAAGAAGAATTTGTCAAAAGGTCGGAGGAAGCAGTAGAGATGCCACACGAAGAGAGACAAGCAGGGGCGCGAAAATGGCGACGCCCGCGAAAGCCTCGCAAAATTATGAATCGAGACCAGGAACTGGCGCTGAAAGAAGCTACACTCAGGAAACAGCAGAGACACAGGGAACCAAAGCTAACAGAGCGAGATTTATTGGGGAAAACCGCACCCACCGTTACCTCTCCATTTTTGCTGTACGGAGGACTCCTGGCAACGGCATCGTGTACAAGTGTTCGACGACGTAGAACACGAAGACGACATACAATGACAATAGGCGAAGTTCGGAAGGGTGAT 
Protein Sequence
RITSLFRCAHLLAFCFLAYSFASPEADIVSCGGUMLNRMPELKSFLKDGEAEWYVGVNVTYVTGRRAVMHIYNEGGSKVEVIDLXVSKLQTKKALHALMAEEEFVKRSEEAVEMPHEERQAGARKWRRPRKPRKIMNRDQELALKEATLRKQQRHREPKLTERDLLGKTAPTVTSPFLLYGGLLATASCTSVRRRRTRRRHTMTIGEVRKGD 
SECIS Sequence
 

Structure Picture