Sy.mi-MSRA-1-U

General Information

Protein ID
822 
External ID
 

Protein Information

Protein Name
Sy.mi-MSRA-1-U 
Family
MSRA 
Species
Symbiodinium minutum 
Genome
DF239254 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CAGGTTGCTACCTTTGCTATGGGCTGATTCTGGGGCCCACAGGCCCGGTTGATACCGGAGAGCTGGGCAGTGGCAATGACCGTTGGATACACTGGGGGTAGAAATCCAAAGCCTTCCTACGAAACTGTTTGTGGTGGAGATGGTCACACAGAGGCCATCCAGATAGAGTATGATCCTGAGGAGATCAGCTACGAGATGCTGCTGGATCAATTCATCAAGGGCCATCAGCCTATGCGTTCAAAAGCTCAGTACAAATCGGCTGTTTGGTACCACAGCGACGAACAAAAGAAG 
Protein Sequence
QVATFAMGUFWGPQARLIPESWAVAMTVGYTGGRNPKPSYETVCGGDGHTEAIQIEYDPEEISYEMLLDQFIKGHQPMRSKAQYKSAVWYHSDEQKK 
SECIS Sequence
CCUUGUCUAUCCUCGUCCGACAAAACUCCCCUGAACCGCAGCAGGCCAUCGUGUAUGCCUCAUUGCGUUCCAUGCGAGAAAAAGAAGGUAAGUUCGGGCAUG 

Structure Picture