3_Ch.re_MSRA_E

General Information

Protein ID
813 
External ID
 

Protein Information

Protein Name
3_Ch.re_MSRA_E 
Family
MSRA 
Species
Chlamydomonas reinhardtii 
Genome
 
EST
gi|161790209|gb|FC076988.1|FC076988,gi|10769903|gb|AV620728.1|AV620728 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCATCACCTACCACGAGCAGCAGCCGGAGGTTCAGCCGGGACATCTCCGCGATGGCGACTAACGGGAACGGAGCTTCTGGCGCGGAGCTCGCCACTTTCGCGCTTGGCTGATTCTGGCACCCGGAGGCTTCGTTCGCGAAGCTTCCCGGTGTGGTGAAGACTCGCGTGGGCTACACGGGCGGCAGCCGCCCCAACCCCACCTACGAGTCTGTGTGCGCTGGCGACGGCCACACAGAGGCGATGCGGGTTTGGTTTGACCCTGCCGTCATCTCGTACGAGGACTTGCTCAAGGTGTGTGTGTGTGTTTCGTGTGTGTTTGTGTTTATGTTTGTTTGCGTATTGCAGCTGCTGCTGAATGTGCCCGCCCTTGTGCTGCTGCTGGTGCTGATGTCCTATGCGTGCAGCAATTCTTCCGGGAGCACGACCCCACCCAGAAGTCCAAATGCCAGTACAAGTCGGCTGTGTGGTACCACAGCGAGGAGCAGCGCACCGCCCTGGCCGCCGTGATGAAGGAGCTGGAGGGCAAGTACCGCGTGCGGCTGGCCACCACTGTGGACCCCGCCGGGGACTGGTGGGACGCGGAGGAGTACCACCAGAAATACATTGAGAAGTCCATGATGCGCCGTGGCTCTGCGGGCTGGTGGTGA 
Protein Sequence
ASPTTSSSRRFSRDISAMATNGNGASGAELATFALGUFWHPEASFAKLPGVVKTRVGYTGGSRPNPTYESVCAGDGHTEAMRVWFDPAVISYEDLLKVCVCVSCVFVFMFVCVLQLLLNVPALVLLLVLMSYAXQFFREHDPTQKSKCQYKSAVWYHSEEQRTALAAVMKELEGKYRVRLATTVDPAGDWWDAEEYHQKYIEKSMMRRGSAGWW* 
SECIS Sequence
 

Structure Picture