Os.sp-MSRA-1-U

General Information

Protein ID
787 
External ID
 

Protein Information

Protein Name
Os.sp-MSRA-1-U 
Family
MSRA 
Species
Ostreococcus sp. RCC809 
Genome
 
EST
gi|254310798|gb|GR823672.1|GR823672 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCGAGCTCGACCGGCGCCGAAATCGCCAAGGGTGACGGTTTCGTCGTCCCAGAAGGTTGTCAGCTCGCGGTGTTCGCGTCCGGGTGATTTTGGGGCCCCGACGCCGCGTTCAGCGCCCTCAAGGGGGTGAAGAAAACGCGCGTCGGTTATACTGGCGGTGATACCGATTTTCCGACGTACTCGCAGGTGTGCGCGGGCGGGACGGGGCACACGGAGGCGTACTACGTGTGCGCCGACGCGGGGGTCATCGGCTACGACAAACTTCTCGAACAGTTTTGGTCCGAGCATCAGCCGACGTACGAGTCCAAGGCGCAGTATAAGTCTGCGATCTGGGCGCAGACGCCGGAACAGTACGAGATGGCTTTGGCGAGCAAGGATGCCGCCGAGAAGCGCGTGGGGAGGAAGATGTTCACGGATATTTATCCACCGGAAGTTTCCCACAGCGTCTCGTGGTGGGACGCGGAAGAATATCATCAAAAGTACTATTGCAAACCTCGCGCCTCGAGATTTGGTTGGTGA 
Protein Sequence
ASSTGAEIAKGDGFVVPEGCQLAVFASGUFWGPDAAFSALKGVKKTRVGYTGGDTDFPTYSQVCAGGTGHTEAYYVCADAGVIGYDKLLEQFWSEHQPTYESKAQYKSAIWAQTPEQYEMALASKDAAEKRVGRKMFTDIYPPEVSHSVSWWDAEEYHQKYYCKPRASRFGW* 
SECIS Sequence
GAUGUCCACGGAGACGCCGCGCGCGCGAGGGUGACGACGGAGACAAAAAAGGCUACGCCUUCGUCUACGUCCGAUAAACCGCGCCGCGGACGCCAUG 

Structure Picture