1_Th.ps_SELENOM_E

General Information

Protein ID
771 
External ID
 

Protein Information

Protein Name
1_Th.ps_SELENOM_E 
Family
SELENOM 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162391280|gb|FC532908.1|FC532908,gi|162385152|gb|FC526772.1|FC526772 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGATTCTGGTTAGAATATTTCCCCCGGTATTACTTTTCCTATCCATGCTTCTCGTTTGGAGTGATGCCCAAGAACAGCGACTCACAGGTCTCATTGAGTCATGCTCGGGATGAGCACTCAATAGGCTGCCTGAATTGAAATCGTTTCTTAAGGATCTGAATGGCGTAGATCTTTACAAGAATGTAGAGGTTCATTTCATAAGTGGCAAAAGGGCGGTGTTGACGATATTTGAGGGAGGAAGGGAGTTGGAGAAGATCACGTTGAGTGATTACAATGACAAGGAGAAGTTGCATACTTTGTTTGCAGAGAAGGGATTTGTGAAGTATACAGGCGTTGAACTGGCGGAGAGGAGAAAGGTGGAGGCAGAGGAAACTGGATCTCTGCAAAAAACGCTCGAGGCACAGCGATATTCTTTGAGCAAAAGAGAACAGAAACTACAAATGAAGGAGAGGCTGAAGAAACTACAAACAGCTAGAGACAACTACATGATAGAGGCTCCTTTCGTGGAGCAGTAG 
Protein Sequence
MILVRIFPPVLLFLSMLLVWSDAQEQRLTGLIESCSGUALNRLPELKSFLKDLNGVDLYKNVEVHFISGKRAVLTIFEGGRELEKITLSDYNDKEKLHTLFAEKGFVKYTGVELAERRKVEAEETGSLQKTLEAQRYSLSKREQKLQMKERLKKLQTARDNYMIEAPFVEQ* 
SECIS Sequence
 

Structure Picture