Os.ta-SELENOM-1-U

General Information

Protein ID
755 
External ID
 

Protein Information

Protein Name
Os.ta-SELENOM-1-U 
Family
SELENOM 
Species
Ostreococcus tauri 
Genome
CAID01000002 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGACGGTCGCTCGACGACGCTCGAGCGCGAGTTTTCTCTTCGCCTTCGTGCTCTTCCTCGCGTGCGCGTCGTCGGCGCTCGCCGAGTCCGCAACGTCGTACGCTCGAGCGCAGTTTCAGTCGTGCCCGGGTTGACGATTGAACCGACTTCCCGAGATCAAGGCGTTCATCAAGGACGTCGTGGAGGTTGGGAAGTACGGAGACAAAGTGAGCGTGCTGTGGACGCACGGACACGCGCCGACGATACACATGCAGGACGATAAAGGGACGAACGTGGAGTCAGTGGTGTTGACAAGCGAGTGGACGGTGGACCAAGTGAAGGAGTACTTGAGCGAGAGAGGATTCGATCCGATCAAACAGGAGAAGTCTGAGCTT 
Protein Sequence
MTVARRRSSASFLFAFVLFLACASSALAESATSYARAQFQSCPGURLNRLPEIKAFIKDVVEVGKYGDKVSVLWTHGHAPTIHMQDDKGTNVESVVLTSEWTVDQVKEYLSERGFDPIKQEKSEL 
SECIS Sequence
 

Structure Picture