1_Pa.lu_SELENOH_E

General Information

Protein ID
727 
External ID
 

Protein Information

Protein Name
1_Pa.lu_SELENOH_E 
Family
SELENOH 
Species
Pavlova lutheri 
Genome
 
EST
gi|106856172|gb|EC174549.1|EC174549,gi|106855730|gb|EC174107.1|EC174107 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGCAGAAGGCCGCGAGCACGTTCATCGTCACCTTCGGCTCGAGCTGAGACGGCGGGCTGCAGGAGCGGGATGCAGCGATACGGTTCATTCGCGAGATCCTCCCCGACGCCGAGGTTCAAGCCAAGCTCGCGCACACGTCGTCCGTCACGATCACGTCGGGTACCGGCGTGACGGTCTGGTCGGGCGCGCAGCGCTCGCTGTACCGCAAGTACGGCTGGCCTGCGCAAAAGGACATCCAGGCGCGCCTCGAGATGTACAAGGAGGACGTCCTCGGCATGTAG 
Protein Sequence
MAQKAASTFIVTFGSSUDGGLQERDAAIRFIREILPDAEVQAKLAHTSSVTITSGTGVTVWSGAQRSLYRKYGWPAQKDIQARLEMYKEDVLGM* 
SECIS Sequence
 

Structure Picture