Ba.pr-SELENOT-1-U

General Information

Protein ID
721 
External ID
 

Protein Information

Protein Name
Ba.pr-SELENOT-1-U 
Family
SELENOT 
Species
Bathycoccus prasinos 
Genome
NC_024002 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GACGCGATTTCCGTGGGAGATAGAATCCACATCTCCTTTTGTCAATCCTGACAATACCGAGGCGGGTTTGAACACGTTCGTCAGATTTGTTCGCACCATTTTGGTCGAGACGTGGATATCGTCCCGACGAATTACCCGCCGAAACCTGCGATGAGAGTATTGACGCGATTGACGAGTTACGCGCAAATAGGGATGCTTGGGGTGACTTTTCGAGGGTCGCAATTTATTCGAGAGTTGTTTCCAGCCGGGACGCAAATCCCGGACTGGGTGTCGTCCATGGAAACGAATAAGATGCACTCGATGTTAACGATTCACTTCCTCGGGAACTTGTTGAAACAGAATTTTGGGAACACCGGGGCGTTCGAGATTTATTACGACGGGGACGTCGTGTTTAGCAAGTTGAAGGAGAAGAGAATGCCGAGGTTGGAGGAGATCGTGGACGGGATACGCGAGAGA 
Protein Sequence
DAISVGDRIHISFCQSUQYRGGFEHVRQICSHHFGRDVDIVPTNYPPKPAMRVLTRLTSYAQIGMLGVTFRGSQFIRELFPAGTQIPDWVSSMETNKMHSMLTIHFLGNLLKQNFGNTGAFEIYYDGDVVFSKLKEKRMPRLEEIVDGIRER 
SECIS Sequence
GGAACACACUCAAACACAUGCACUCACAAAGUGAUGGCGAAGAAGUAAAAAAGGAACGCACAGAACGUGCGUGCGCUUCUUUUGCCGGAUAGAAGAGUUUUUGGGAAGAG 

Structure Picture