2_Os.sp_SELENOH_E

General Information

Protein ID
711 
External ID
 

Protein Information

Protein Name
2_Os.sp_SELENOH_E 
Family
SELENOH 
Species
Ostreococcus sp. RCC809 
Genome
 
EST
gi|254311976|gb|GR822205.1|GR822205,gi|254312520|gb|GR824273.1|GR824273 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTCTGGGGACGACGTGACGGTGACGTTCAGTCACAACTGAGACGGGGGGATGCAAGAATTCGAAGCCGCGAAAGCGGCGATTCTTAACGTGAGACCGAACGCGAACGTGGTGGCGAACCGGGTGGATAAATATCCAATCACGGTGACGGTTTCGTCGGGAGGTAAAGACGTCTGGAGCGGAAGACAACAGGGGTTGTTCCGTAAGAATGGACGACCGGCGATGAAAGAGATCGAAGACGCGATGCGTGGCTTGCAGTAA 
Protein Sequence
MSGDDVTVTFSHNUDGGMQEFEAAKAAILNVRPNANVVANRVDKYPITVTVSSGGKDVWSGRQQGLFRKNGRPAMKEIEDAMRGLQ* 
SECIS Sequence
 

Structure Picture