Ni.hy-SELENOM-1-U

General Information

Protein ID
710 
External ID
 

Protein Information

Protein Name
Ni.hy-SELENOM-1-U 
Family
SELENOM 
Species
Nitella hyalina 
Genome
 
EST
gi|372658670|gb|HO558224.1|HO558224 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGTCTGCAGCCTTCGCATCTTTGTTCTGCCTACTGCTTGCCAGCGCAACGTTCGCCAACGCTGAAATCACACGCGGGGAGTTCCAAACCTGCGGTGGCTGAAAGCTGAACCGACTGCCTGAAGTGAAACGTTTTATATTCGACGTTGCTCACGCAGGGGTCTATCCAGCTGTCAGTGTTACTTTCATTCCCAGGACATACACCAGAACTTGA 
Protein Sequence
MSAAFASLFCLLLASATFANAEITRGEFQTCGGUKLNRLPEVKRFIFDVAHAGVYPAVSVTFIPRTYTRT* 
SECIS Sequence
 

Structure Picture