Ul.li-SELENOT-1-U

General Information

Protein ID
708 
External ID
 

Protein Information

Protein Name
Ul.li-SELENOT-1-U 
Family
SELENOT 
Species
Ulva limnetica 
Genome
 
EST
gi|343957620|gb|AB576827.1|AB576827 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGGTGCGGGGCTTCAGCCAGCTGACCATTCTGCCGGAGGTAAGGTCCACATCAGCTATTGCAGTGGCTGAGGCTACGCAAACGCCTTCCAGCAGGTCCGCCAAGCCGTCAAATCGGAGCCCGGACTGTCGGACCTGCATGTGACAGGCGCTACACACCCTCTCACCCCTCCACGCTACATCGCTTCCGTGGTCGCAACAACTGCACAGTACTCGTTCATTGCATTTGTTGCGGCTGAGGATCGCTACGTGTTCCCCGTCTTGCGCCTTCCTGTTCCGCCGTGGTACAGGACGATGACCGAGAACCGCATCGCGGCAGTGATGATGGCATTCTTTGCGGGCAACGTCGTAACCAATTCCTTGTCCCAGACTGGCGCCTTCGAAGTGTACTACGACGGAACGCTGGTATGGTCAAAGCTTCAATCCGGGCAACCTCCCAACCTGGCGCAAATCATCGGGGCGCTG 
Protein Sequence
MGAGLQPADHSAGGKVHISYCSGUGYANAFQQVRQAVKSEPGLSDLHVTGATHPLTPPRYIASVVATTAQYSFIAFVAAEDRYVFPVLRLPVPPWYRTMTENRIAAVMMAFFAGNVVTNSLSQTGAFEVYYDGTLVWSKLQSGQPPNLAQIIGAL 
SECIS Sequence
 

Structure Picture