1_Bi.na_SELENOM_E

General Information

Protein ID
705 
External ID
 

Protein Information

Protein Name
1_Bi.na_SELENOM_E 
Family
SELENOM 
Species
Bigelowiella natans 
Genome
 
EST
gi|66860028|gb|DR039543.1|DR039543 
Functional Domain
 
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGATAATGAAAACTATCTTCACGTTTGCCCTGATAATGTTAACGGCCTCCCCAATATCAGCTGATTCAGAAGTGTCTTCTGTCATCGTAAAGAGTTGCAGAGGATGAAAGCTGAATCGTCTTCCGAAGCTGAGAAAGTTTCTGAAGACGCAGTGCTGTTCCCAATACAAGAATCTTGATATTGAATGGATCAGTGGTCATATACCGACAGCTTATTTCAAAAATGAAAATGGGGACATCCTCAAAGAGGAGAAAATAGGAGATAGGGATGAGGAGCAGATGTTCAGTTTTTTTGAAGAGAACGGGTTTAAACTCATTCCCGCAGAGACGGCGAAATCAGAGCTCTAA 
Protein Sequence
MIMKTIFTFALIMLTASPISADSEVSSVIVKSCRGUKLNRLPKLRKFLKTQCCSQYKNLDIEWISGHIPTAYFKNENGDILKEEKIGDRDEEQMFSFFEENGFKLIPAETAKSEL* 
SECIS Sequence
 

Structure Picture