Ec.si-SELENOM-1-U

General Information

Protein ID
70 
External ID
 

Protein Information

Protein Name
Ec.si-SELENOM-1-U 
Family
SELENOM 
Species
Ectocarpus siliculosus 
Genome
FN649736 
EST
gi|241966449|gb|FP255577.1|FP255577,gi|242148499|gb|FP261375.1|FP261375,gi|242149074|gb|FP268171.1|FP268171 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAAGCTTTTCGCGTTCGTGATCGGGGCACTTTTCGTGTCCCGGGCTTGCGCCCAAGCGGCGGCGATGAGGGGCCACATCGTGTCCTGCTCCGGATGAAAACTAAACAAGCTCCCCGAGGCCAAGAAATTCCTCAAGAATCCCGAGCACGCCGCAAGCTACGAGGATATCGAAGTAGAATTCAAGGCCGGCAAGCCGCCGGTGTTGACCCTTTTCGACAAGGCCTCCGGGGAGGAGACGGAGAGCATCAACCTCGAGAAGTTTACCATCGATGAGATGCACGAGCTTCTCGTGTCTAGGGGATTCGTCCGCCGTGCGGATGCCGCGGACCTCGCCGAGGTGAAGGCGAAGGAAGCCATCGCTGACGAAGCCGCCGCGAAGCAGAAGAAGGAACGGGCCGAGGCCGCTGCCAAGCGCAGGCTAGAGAGGGAGAACAACAGACCGGACAAGGGGGCCGCCAAGGCCCATCAAGCGGAAGGTCGCGCCGCTATGGCCGAGAAGCGCAAATTTGACGCCGCGAAGCGGAAGGCCAGGGAAAGCGAGGCCGGCGGCAGCGGAGAGCTGTAG 
Protein Sequence
MKLFAFVIGALFVSRACAQAAAMRGHIVSCSGUKLNKLPEAKKFLKNPEHAASYEDIEVEFKAGKPPVLTLFDKASGEETESINLEKFTIDEMHELLVSRGFVRRADAADLAEVKAKEAIADEAAAKQKKERAEAAAKRRLERENNRPDKGAAKAHQAEGRAAMAEKRKFDAAKRKARESEAGGSGEL* 
SECIS Sequence
VIGALFVSRACAQAAAMRGHIVSCSGUKLNKLPEAKKFLKNPEHAASYEDIEVEFKAGKPPVLTLFDKASGEETESINLEKFTIDEMHELLVSRGFVRR 

Structure Picture