Th.ps-MSRA-1-U

General Information

Protein ID
692 
External ID
 

Protein Information

Protein Name
Th.ps-MSRA-1-U 
Family
MSRA 
Species
Thalassiosira pseudonana 
Genome
CM000638 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAACAACATTTGCCCCGAGATTCCAACCGCACCGCAAAAGGCCCTTTCCAATGAGGTGGCCGTTCTAGCTAGTGGATGATTCTGGCACCCCCAGCGCGACTTTAAAAGGCTGGAGGGAGTTGTCGATGTGATTGTCGGCTACACAGGAGGGCAGAAGAAGAATCCAACGTATCAGAACATAATGGATGCCACAGAGGCTTTTATCGTGGAGTTTGATCCGTCTGTGATTTCTTACGAAGAGATATTGAATGAGTGGGCAGCCCAACATGCACCGTTCTACCCCAGTAAATGCCAATATAGATCGGCGATATTTTACTGCAGTGAGGAACAACAATCCGCAGCTCAAAAGAAGATTGAAGAGCTGGGGAAAGATGGTCAGCGATCAGTGTATGTTGATTTGGAACCCGTGTCTGCGTTCTACCGAGGGGAAGAGTACCATCAAGACTTTCTAGACAAACAAGCTGGTGCTCGGGCTCCAATGTTT 
Protein Sequence
MNNICPEIPTAPQKALSNEVAVLASGUFWHPQRDFKRLEGVVDVIVGYTGGQKKNPTYQNIMDATEAFIVEFDPSVISYEEILNEWAAQHAPFYPSKCQYRSAIFYCSEEQQSAAQKKIEELGKDGQRSVYVDLEPVSAFYRGEEYHQDFLDKQAGARAPMF 
SECIS Sequence
CACACAAACAACGCUGGUUCUAGGUGCUAUAUGAAGAGGCUGCACGGAAAUGACGGAUCCUUUUGUCGACUUUCAGUUCAGAUUUGGAUCUCGAGAAUCGUGGAGUCUGUGGA 

Structure Picture