He.tr-SELENOT-1-U

General Information

Protein ID
685 
External ID
 

Protein Information

Protein Name
He.tr-SELENOT-1-U 
Family
SELENOT 
Species
Heterocapsa triquetra 
Genome
 
EST
gi|73768506|gb|DT382363.1|DT382363 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
TTCCGGTTCTGCATGAGTTGAGGCTACAAACAGGTGTTCATGGAATACGCTCGGCGGCTGCACGAAGCGTTTCCTGGCACCCGGATCTCTGGGGAGAACTACCCCCCTCCCCCCCTCAATGCTTTCCTCTCCTCCGTC 
Protein Sequence
FRFCMSUGYKQVFMEYARRLHEAFPGTRISGENYPPPPLNAFLSSV 
SECIS Sequence
 

Structure Picture