Ka.br-MSRA-1-U

General Information

Protein ID
677 
External ID
 

Protein Information

Protein Name
Ka.br-MSRA-1-U 
Family
MSRA 
Species
Karenia brevis 
Genome
 
EST
gi|48702233|gb|CO060064.1|CO060064 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGATCGGCCTGCTGGTCAGCATAGTGGCGAGCCAGTTGACGGAGGNGCNTCGNTGAACATCAAANTCNTCGACAGACTANCTGCTGAGCTCANACATGACANANCAAGTTCCCAAAGCANAGACAGTGGACGACGAGAAGTTGCAATTTTAGCACTTGGCTGATTCGATAGTGCANAGATGTTTGACCAACTTGGTGGTGTAAAGAGCACCTTGATTGGGTACACTGGTGGAACCTCCACGCAACCTAATTACTGGAGTGTCTGCGCGGGAGATGGTCACNCAGAGGCGATAAAGATAATATTTGACCCAGAACAAATTTCGTACGAAGAGCTACTCTACAACTTCTTCTTGTTGCATTCTCCACGAGACTCCAGCACCCAATATAAGTCTGCGATATGGTATGCANGCGAGGAGCATAAAAAGAGTTGCTGA 
Protein Sequence
MDRPAGQHSGEPVDGGASXNIKXXDRLXAELXHDXXSSQSXDSGRREVAILALGUFDSAXMFDQLGGVKSTLIGYTGGTSTQPNYWSVCAGDGHXEAIKIIFDPEQISYEELLYNFFLLHSPRDSSTQYKSAIWYAXEEHKKSC* 
SECIS Sequence
 

Structure Picture