Fr.cy-MSRA-2-U

General Information

Protein ID
665 
External ID
 

Protein Information

Protein Name
Fr.cy-MSRA-2-U 
Family
MSRA 
Species
Fragilariopsis cylindrus 
Genome
scaffold_60 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
GCGAAAAAAATCTGTCCATTATTACCACCACCAGCAGATCCTCAGACAACATTTGAGGCAGCAATGGGATGATTTTGGGGCCCTCAACGTGATTTCGATCAGACCGAGGGCATTGCGAGTACCGTGGTTGGATATTCTGGTAGTGTCTCACGTGACTCGACAGTAAATCCAACGTATCGGAATATACGTGATTATGCAGAAAGTATCCGTATTACCTATAATGCTGATAAATTAAAATATGAAGATATGTTAGAAATGTTTTTTGATATGCATACACCATCCGACTCGCGATTTGGTGGTACACAATACCGATCAGCTATATTTGTTTACACAGAAGAACAAAAA 
Protein Sequence
AKKICPLLPPPADPQTTFEAAMGUFWGPQRDFDQTEGIASTVVGYSGSVSRDSTVNPTYRNIRDYAESIRITYNADKLKYEDMLEMFFDMHTPSDSRFGGTQYRSAIFVYTEEQK 
SECIS Sequence
GUAUUACCUAUAAUGCUGAUAAAUUAAAAUAUGAAGAUAUGUUAGAAAUGUUUUUUGAUAUGCAUACACCAUCCGACUCGCGAUUUGGUGGUACACA 

Structure Picture