Th.oc-SELENOT-1-U

General Information

Protein ID
647 
External ID
 

Protein Information

Protein Name
Th.oc-SELENOT-1-U 
Family
SELENOT 
Species
Thalassiosira oceanica 
Genome
AGNL01004378 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
ATTCAGTTTTGCACATCATGAGGGATGAAGGCTAACTTCATGAAGTTGCGGGAAATAATGATGTCGGAATTCCCCGACCAGTGGAGTGAAATCAAGGGGGCGAATTACCCCGTTCCGGAGTGGACTGTGTACGCTGGGCAGGTCATGTCCATGGTGCAGTTATTTGCCATGGCTGTGATATTAATCGGTGACTCGCTCTGGACGTACATACCGGGATTCTCACGCGGGCCTCCAGAGTTTTATTTCCAGATGAAAGAGAACCCGGCACTGGCCTTCATCATCGTCTTTCTGGTCGTGCCCAGTTACATCCAGAGTTATACCAACACTGGGGCCTTCGAGGTGATTGTCGACGGGAAGCTCGTATTTTCTAAATTGGAGTCAGGTAGGATGCCGAACGTTCCCGAGATCCTTCGCGCGCTTCAGGCTGCTGGACTGAAAAAG 
Protein Sequence
IQFCTSUGMKANFMKLREIMMSEFPDQWSEIKGANYPVPEWTVYAGQVMSMVQLFAMAVILIGDSLWTYIPGFSRGPPEFYFQMKENPALAFIIVFLVVPSYIQSYTNTGAFEVIVDGKLVFSKLESGRMPNVPEILRALQAAGLKK 
SECIS Sequence
 

Structure Picture