Gu.th-SELENOT-1-U

General Information

Protein ID
640 
External ID
 

Protein Information

Protein Name
Gu.th-SELENOT-1-U 
Family
SELENOT 
Species
Guillardia theta 
Genome
AEIE01004425 
EST
gi|557436369|gb|HE992952.1|HE992952,gi|557430955|gb|HE987102.1|HE987102,gi|557431457|gb|HE987742.1|HE987742,gi|117383790|gb|EG718245.1|EG718245 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGGGAGAGTGGCGAGTACTGGCGGTGCTCGCTACCGTCTTCCTCATCGATGGGTACAGGAGGTACACGAGTAGTCAGGCCGAGGAGAAGGAGAAGGCAGTCAGCGAGCAGGAGCTCGACCCCTCCTTCCGGTTCAAGGACCACGAAGCCAATCGCCTCCACATCCTGTATTGCCAGGCAGGGTGAGGCTACAAGAAGGCTGTAGTGGAGTACTCCAACTACCTACAGCACAGGCTCCCTGGCCTAAAGATAACTTCGGAGGAGAACGATGCTCCCGCTCATCTTCGGGCGCTTGCCTCGATGGTCAGCTATGCTCAGATGGCGGGATTTGCCGTTGCCTTCTTTGGCACGCAGATGTTTGCTGCATTGAGTATGCCTGTACCGCAATGGGCGAATTACATGCAAGAAAACAAAGGAACTGCAATCATGGGATTCTTCCTTGGCAACATGGTGATCAGTGGCCTCATCGCGACAAACGCGTTCGAGGTGTACTTGGGCGGCGAGCTTGTCCATTCCAAGATCAAGACGGGAGTCTTGCCTGACATCCATTGGTTGGTCAAGGAGCTTGTATCAAGAAATCCTGCTCTTGATCAAGCTGTTCCGAAATGA 
Protein Sequence
MAGEWRVLAVLATVFLIDGYRRYTSSQAEEKEKAVSEQELDPSFRFKDHEANRLHILYCQAGUGYKKAVVEYSNYLQHRLPGLKITSEENDAPAHLRALASMVSYAQMAGFAVAFFGTQMFAALSMPVPQWANYMQENKGTAIMGFFLGNMVISGLIATNAFEVYLGGELVHSKIKTGVLPDIHWLVKELVSRNPALDQAVPK* 
SECIS Sequence
LHILYCQAGUGYKKAVVEYSNYLQHRLPGLKITSEENDAPAHLRALASMVSYAQMAGFAVAFFGTQMFAALSMPVPQWANYMQENKGTAIMGFFLGNMVISGLIATNAFEVYLGGELVHSKIKTGVLP 

Structure Picture