Me.vi-SELENOH-2-U

General Information

Protein ID
630 
External ID
 

Protein Information

Protein Name
Me.vi-SELENOH-2-U 
Family
SELENOH 
Species
Mesostigma viride 
Genome
 
EST
gi|60430128|gb|DN261518.1|DN261518,gi|60430127|gb|DN261517.1|DN261517 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGTTCCCAAACGGAAACCTGCTGCCAAAGAAGTCGAGGCACCTCCAAAAAAGCCTAAGGAAAATTCGGCCGAAACGGCAAAGCCAGGCCAGAGCGTTCCCGCCACCAAGTCGCGTGTCACGGTCGAGGCATGCAAGCAGTGAGGTGCATTCAAAACGAGGGCGGTAAAGTTGGAAAAATACCTTAAAGAATCGGATGTTGGAAGCCGCGTGGAGGTCATTATCAATGAGATACCCCCTCGTCGCGGATGTTTCGAGGTCCGCGTGGGAGACGAGGCGGTGGTTTCTTTGCTGGACTTGAAGCGGCCATTCCCAGCCTTGAAGGCTCTTGACATGGACGACATAGGAGCCAAGATCGTGGAGAAGCTAAAGGCAAAGTGA 
Protein Sequence
MVPKRKPAAKEVEAPPKKPKENSAETAKPGQSVPATKSRVTVEACKQUGAFKTRAVKLEKYLKESDVGSRVEVIINEIPPRRGCFEVRVGDEAVVSLLDLKRPFPALKALDMDDIGAKIVEKLKAK* 
SECIS Sequence
 

Structure Picture