Os.lu-SELENOH-1-U

General Information

Protein ID
627 
External ID
 

Protein Information

Protein Name
Os.lu-SELENOH-1-U 
Family
SELENOH 
Species
Ostreococcus lucimarinus 
Genome
CP000582 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
CGAGACGATGATTTTCGCGCGATCGCAGCCAAGAAGAAGCCCGCGGCCAAGAAGAAGCCGGCGGCTAAGAAGAAGCCGGCGGCCAAGAAGAAGCCGGCGGCCAAGAAGGCCAAGGCCAAGGCTTCCAAGAAGTGAGGCGTGTTTCTGCGCTCGGCCGAGCGTTTACGAACGCTTCTCGCCTCGGCGGGAATTGAAGTGGAAATAGAGCGAGACAACACTTGTCGCGGGTTTGAAGTTTTCGTGGACGACGTCGCGGTCGTGTCCCTTTTGGACATGCCCCGACCGTTCGTGAAGCTTCGAGCGCTCGATCTCGAACGAGTCGCAAAGGATGTAAGTTCTTTGTGCGCG 
Protein Sequence
RDDDFRAIAAKKKPAAKKKPAAKKKPAAKKKPAAKKAKAKASKKUGVFLRSAERLRTLLASAGIEVEIERDNTCRGFEVFVDDVAVVSLLDMPRPFVKLRALDLERVAKDVSSLCA 
SECIS Sequence
UAACGACGACUACGACGCGCGAUCGAUCGAGUGACGCCGCGGAGGCUAAACUCGCGAUUUCGCGAGCGUUCCCGCGGUCGAUUGAACUUCGAAAGGUUGCGU 

Structure Picture