3_Th.ps_SELENOM_E

General Information

Protein ID
626 
External ID
 

Protein Information

Protein Name
3_Th.ps_SELENOM_E 
Family
SELENOM 
Species
Thalassiosira pseudonana 
Genome
 
EST
gi|162369116|gb|FC511399.1|FC511399 
Functional Domain
 
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GCCACCCTCCACGGAAGAATTGAATCCTGCTCTGGATGAAAATTGAACAAGCTTCCAGTTCTCAAATCCTTCCTAAAAGATGGAGAGGCAGAATCGTATAGAAACGTGGAGGTGAAGTATGTTCCTGGGAAACAGGCTGTATTGACGATTTATGAGGGTGAAGGGGAGGAGGTGGAGGGATGGGTGGAGAAAGAGAAGATTGTGTTGAGTGAACTCGAGACCAAGGTGACTGTTGTTTGGGTGTTGACTGAATGTTGTTTTATGTGTTGCAATTCAGCTGTATTTATTTATCTTGGTGCTTTTTCTTGATAGGAGGAGATGCATGCCTTGATGGTAGACAAGGGATTTGAACTGCGATCAGAAGAAGAAATAGCAGAACGCAAAGCGGAAAAGGAGAAAGAGGAGAAAGAACTGGCTGAAATGAGGAAGCGAAGACAAGCTGCATCGCAGGAAGCACGGCGCAAAAAGCAGAAGGAGCAGAGAGTGGACGATTTGAAAGACAAGGATGAGCTTTAG 
Protein Sequence
ATLHGRIESCSGUKLNKLPVLKSFLKDGEAESYRNVEVKYVPGKQAVLTIYEGEGEEVEGWVEKEKIVLSELETKVTVVWVLTECCFMCCNSAVFIYLGAFSJOEEMHALMVDKGFELRSEEEIAERKAEKEKEEKELAEMRKRRQAASQEARRKKQKEQRVDDLKDKDEL* 
SECIS Sequence
 

Structure Picture