Bi.na-MSRA-2-U

General Information

Protein ID
623 
External ID
 

Protein Information

Protein Name
Bi.na-MSRA-2-U 
Family
MSRA 
Species
Bigelowiella natans 
Genome
ADNK01003260 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GAAACACCTCCCAACACATGTACGTTCGGTATGGGATGATTTTGGGGCGCAGAGGACCTGTTCTCACCTTCCAGGCGCCCAGGAGTCGTCTCTACGCGGGTTGGCTATACGGGAGGAGAGAAAAAGGATCCTAGTTACAAGTCCTTAGCAGACCATACGGAGGTGGTGCAGGTTACGTTTGATCCGTCGATGGAATCCTATCGAAATTTGGTTGATATCTTTTTTTCTAATCACGACTTTGCACTCAAATCTGGCTCCAAG 
Protein Sequence
ETPPNTCTFGMGUFWGAEDLFSPSRRPGVVSTRVGYTGGEKKDPSYKSLADHTEVVQVTFDPSMESYRNLVDIFFSNHDFALKSGSK 
SECIS Sequence
ACCGCGUCACAACGCGUUCGCAUCCAGUUCAUGAGACCGUGGAGGGCCUCAAGGCUGAUUCUCUUCGUCUGAGAGAGGACUAGAUCUGCCUGGCA 

Structure Picture