Mi.pu-SELENOT-1-U

General Information

Protein ID
609 
External ID
 

Protein Information

Protein Name
Mi.pu-SELENOT-1-U 
Family
SELENOT 
Species
Micromonas pusilla CCMP1545 
Genome
GG663735 
EST
gi|303271030|ref|XM_003054831.1| 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGCGGACGCGACCGCAGCGCGAGCGCCCGCGGCGAACGCGTCGCGGCGACCGGCGACCACTCCCGCGGGGTTCAACCCTACGGGCGCGCTCGTCGTGGCGGTCCTCCTCGCCTTCGCCGGCGCGGACGTGTTCACGACGTACAAAGACCACGCGGCGGCGTCCGCGTCCCCCGAGCTCGCGCCGAACGAGTTCGCCGTCGCGGACCCGACGAGCCTCGGCGGGAAAGTTCACATCAGCTTCTGCACGAAATGAAACTACCGCGGCGGGTACGTGCACGTGACCGAACAGATCCAGAAGTCCTTCCCCGGGATGGAGGTGGTCGGTTCGCACCACCCGCCGACGGCGACGAACGCCGCGCTCGCGAAAGCGGTCGGGTTCGCGCAGTTTAGCGCAATCGCGGCGACGTTCAGCGGCGCGCAGGTCTTCCCGGCGCTCGGGATGGCCGTCCCGAGCTTCGTGGCCGGGATGGCGGAGAACAAGCTGCAGTCCGCGGGCGCGGCGTTTTTCTTGGGGAACACGCTGTCGCAGAACTTGCTAAACACGGGCGCGTTCGAGGTGTATTACGACGGCGACGTCGTGTTCAGCAAGCTGAACGAGAAGAGGCTGCCAAACGTGCAGGAGATTTTGCGCGGGTTGGAGTCGCGCGTCGGACGCGCGAGGAAGCGGGCGGCGGAGACGGCGCGACTCGAGGAGGCGACGGCGTAA 
Protein Sequence
MADATAARAPAANASRRPATTPAGFNPTGALVVAVLLAFAGADVFTTYKDHAAASASPELAPNEFAVADPTSLGGKVHISFCTKUNYRGGYVHVTEQIQKSFPGMEVVGSHHPPTATNAALAKAVGFAQFSAIAATFSGAQVFPALGMAVPSFVAGMAENKLQSAGAAFFLGNTLSQNLLNTGAFEVYYDGDVVFSKLNEKRLPNVQEILRGLESRVGRARKRAAETARLEEATA* 
SECIS Sequence
MADATAARAPAANASRRPATTPAGFNPTGALVVAVLLAFAGASPRADVFTTYKDHAAASASPELAPNEFAVADPTSLGGKVHISFCTKUNYRGGYVHVTEQIQKSFPGMEVVGSHHPPTATNAALAKAVGFAQFSAIAATFSGAQVFPALGMAVPSFVAGMAENKLQSAGAAFFLGNTLSQNLLNTGAFEVYYDGDVVFSKLNEKRLPNVQEILRGLESRVGRARKRAAETARLEEATA 

Structure Picture