Vo.ca-SELENOT-1-U

General Information

Protein ID
608 
External ID
 

Protein Information

Protein Name
Vo.ca-SELENOT-1-U 
Family
SELENOT 
Species
Volvox carteri 
Genome
GL378323 
EST
gi|167159901|gb|FD883278.1|FD883278,gi|167097189|gb|FD820593.1|FD820593,gi|167091551|gb|FD815345.1|FD815345 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGCAGTTAAACATCGCGAAAGGAGCCCTACTTCTTGGAATTGTAGGCCTAATGTTTAGCGCGGATGTAATGAGTATGTTTGGGGGTGCTCGAGTGCAAAGTCCCATAGATCCAGATGGTGGCCTTTCGCTGGGTGGACGGGTGCATATCTCCTTCTGCAGTAGCTGAGGAATGCGTGGCGCGTTCGGTCAAGTCCAACAGCTCGTCCGAACGCGTTTTCCCGGGGTTGAGGTTCACGGTACCACGTACCCCTTGCCGGCATGGAAGAGGCCGCTGGTCACGGCGGCTAGGAGCATACAGATGACGGCCTTGGCGTTCTGCATAGCTGGAGACCACATTTTCAGGCAGCTCGGAATGCAGCCAGTGGCTTGGTACACGCAGAACGTGGCATCCAACCGGCCCGGTGCCGTGATGGGCGTCTGGTTCGTAGGCAACATGCTGATTACTAACCTTCAGAACACGGGGGCGTTTGAAATATACTTTGACGGACAGCTGATCTTTTCCAAGCTGGCGGAAGGTCGCATGCCCACAATGGCAGAGCTTTTGGGCCCTATGGAGGCCTACTTTGCAACGGGGGCTGGCGGTGGGTCCAGGACGGCGATGACCGACGCAGCAGCAGCAGCTGTTAGGGCCGGAGGTAACGCTCCACGGGATTCCCGGGCGAGACCGGCTGGCAACGGCGCAGGGGTAGTGGCTCCGGAACCAGACCACGACGGGGAGCTTTAG 
Protein Sequence
MQLNIAKGALLLGIVGLMFSADVMSMFGGARVQSPIDPDGGLSLGGRVHISFCSSUGMRGAFGQVQQLVRTRFPGVEVHGTTYPLPAWKRPLVTAARSIQMTALAFCIAGDHIFRQLGMQPVAWYTQNVASNRPGAVMGVWFVGNMLITNLQNTGAFEIYFDGQLIFSKLAEGRMPTMAELLGPMEAYFATGAGGGSRTAMTDAAAAAVRAGGNAPRDSRARPAGNGAGVVAPEPDHDGEL* 
SECIS Sequence
KGALLLGIVGLMFSADVMSMFGGARVQSPIDPDGGLSLGGRVHISFCSSUGMRGAFGQVQQLVRTRFPGVEVHGTTYPLPAWKRPLVTAARSIQMTALAFCIAGDHIFRQLGMQPVAWYTQNVASNRPGAVMGVWFVGNMLITNLQNTGAFEIYFDGQLIFSKLAEGRMPTMAELLGPMEAYFATGAG 

Structure Picture