Ul.pr-SELENOT-1-U

General Information

Protein ID
605 
External ID
 

Protein Information

Protein Name
Ul.pr-SELENOT-1-U 
Family
SELENOT 
Species
Ulva prolifera 
Genome
 
EST
gi|334721428|gb|GW320771.1|GW320771 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGGGGGTCGGCCTGCAACCGGCTGAACAGTCACTGGGAGGCAAGGTGCACATCACCTTCTGCAGTGGCTGAGGCTACGCAAACGCCTTCCAGCAGGTTCGACAGGCCATTAAAACGGAGCCCGGGCTGTCGGATCTGCAGGTGACAGGCGCAAACCACCCCCTCACCCCTCCCCGCCAAATCGCCTCTGTCACTGCCACAACAGTGCAGTATTCATTCATTGCCTTCATCGCAGCTGGCGATCGATATGTGTTCCCAGCATTACGTGTTCCAGTCCCACCGTGGTACAGGAGCATGACTGAGAACAGAATCGCAGCAATCATGATGGCATTCTTCACCGGCAACATGGTAACAAACTCCTTGGCCCAGTCTGGGGCATTTGAAGTTTATTACGATGGTGTGCTGGTGTGGTCCAAACTTCATTCCGGGCAACCTCCAAATCTGGCACATGTCACTGCGGCGTTGAAAGCAGCGCGGCGGTAA 
Protein Sequence
MGVGLQPAEQSLGGKVHITFCSGUGYANAFQQVRQAIKTEPGLSDLQVTGANHPLTPPRQIASVTATTVQYSFIAFIAAGDRYVFPALRVPVPPWYRSMTENRIAAIMMAFFTGNMVTNSLAQSGAFEVYYDGVLVWSKLHSGQPPNLAHVTAALKAARR* 
SECIS Sequence
 

Structure Picture