Mi.pu-SELENOH-2-U

General Information

Protein ID
60 
External ID
 

Protein Information

Protein Name
Mi.pu-SELENOH-2-U 
Family
SELENOH 
Species
Micromonas pusilla CCMP1545 
Genome
GG663735 
EST
 
Functional Domain
HTML
Function
 

Sequence

Orientation
Reverse 
Nucleotide Sequence
GTGACGTACTGCAGCAACTGAGACGGCGGCGGACAAGAGCTGAACGCGGCGAGAGAAGCCATCTTGTCAGTTCACCCTGGCGCAAAAATCGTCCCGGACCGCATCGACTTCTACCCGATCACCGTGACCGTGAAGCAGGGCGATGACGTCGTGTGGACCGGACGTCAGCAAGGATTGTTCGGTAAAAACGGGAGGCCCGCGCAGGCGGAGATCGTGAAGGCGCTCAAG 
Protein Sequence
VTYCSNUDGGGQELNAAREAILSVHPGAKIVPDRIDFYPITVTVKQGDDVVWTGRQQGLFGKNGRPAQAEIVKALK 
SECIS Sequence
UCCCGUCGUCCCCGUGCUCGUGCGCGUCCGAUGACGCGGCCGCCGCUGAAAGCCUCGCAUCGCAGGCAUGGCGUGCCGCCGAUCACGACGUACGAAACGAGCGAC 

Structure Picture