Ph.tr-SELENOM-4-U-NEW

General Information

Protein ID
596 
External ID
 

Protein Information

Protein Name
Ph.tr-SELENOM-4-U-NEW 
Family
SELENOM 
Species
Phaeodactylum tricornutum 
Genome
CM000611 
EST
gi|186983610|gb|CU724565.1|CU724565 
Functional Domain
HTML
Function
 

Sequence

Orientation
Forward 
Nucleotide Sequence
ATGAAAAATAGAATCACGAGTCTTTTCAGGTGCGCTCATTTGCTGGCGTTTTGCTTCCTTGCTTACTCATTCGCCAGCCCGGAAGCCGACATCGTTTCCTGTGGAGGATGAATGTTAAACCGCATGCCCGAGCTCAAAAGCTTTCTCAAAGACGGCGAAGCAGAATGGTATGTGGGGTTTAATGTGACCTACGTTACGGGTCGTCGAGCGGTCATGCACATACATAACGAAGGAGGGAGCAAAGTGGAGGTCATTGATTTAACTGTAAGTAAGTTGCAGACGAAAAAAGCATTGCATGCTTTGATGGCAGAAGAAGGATATGTCAAAAAGTCGGAGGAAGCAGTAGAGATGCCACACGAAGAGAGACAAGCAGGGGCGCGAGAATGGCGACGCCCGCGAAAGCCTCGCAAAATTATGAATCGAGACCAGGAACCGGCGCTGAAAGAAGCTACACTCAGGAAACAGCAGAGACACAGGGAACCAAAGCTAGCAGAGCGAGATTTATTGGGGAAAACCGCACCCACCGTTACCTCTCTGTTTTTGCTATACGGAGGACTCCTGGCAACGATCTTGGCAACGGCATCGTGTACAAGTGTTCGACGACGTAGAACACGAAGACGACGTACAATGGAAAAAAGGCAAATTCGTAAGGGGGATGCTGGGATTCAAAAATGGAAAAGTGTTTCGGTGAAGTAA 
Protein Sequence
MKNRITSLFRCAHLLAFCFLAYSFASPEADIVSCGGUMLNRMPELKSFLKDGEAEWYVGFNVTYVTGRRAVMHIHNEGGSKVEVIDLTVSKLQTKKALHALMAEEGYVKKSEEAVEMPHEERQAGAREWRRPRKPRKIMNRDQEPALKEATLRKQQRHREPKLAERDLLGKTAPTVTSLFLLYGGLLATILATASCTSVRRRRTRRRRTMEKRQIRKGDAGIQKWKSVSVK* 
SECIS Sequence
 

Structure Picture